SHROOM1 Antibody
| Name | SHROOM1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32695 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LLDGLIPLAEVRAAMRPACGEAGEEAASTFEPGSYQFSFTQLLPAPREETRLENPATHPVLDQPCGQGLPAPNNSIQGKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SHROOM1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SHROOM1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SHROOM1 Antibody [NBP2-32695] - urinary bladder](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4970_SHROOM1-Antibody-Immunohistochemistry-NBP2-32695-img0003.jpg)
Immunohistochemistry: SHROOM1 Antibody [NBP2-32695] - urinary bladder
![Immunohistochemistry: SHROOM1 Antibody [NBP2-32695] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4971_SHROOM1-Antibody-Immunohistochemistry-NBP2-32695-img0001.jpg)
Immunohistochemistry: SHROOM1 Antibody [NBP2-32695] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
![Immunohistochemistry: SHROOM1 Antibody [NBP2-32695] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4973_SHROOM1%2520Antibody-Immunohistochemistry-NBP2-32695-img0004.jpg)
Immunohistochemistry: SHROOM1 Antibody [NBP2-32695] - liver cancer