POLR3A Antibody
| Name | POLR3A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32648 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVVVQGIPEVSRAVIHIDEQSGKEKYKLLVEGDNLRAVMATHG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | POLR3A Protein |
| Description | Rabbit Polyclonal |
| Gene | POLR3A |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: POLR3A Antibody [NBP2-32648] - breast](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5029_POLR3A-Antibody-Immunohistochemistry-NBP2-32648-img0004.jpg)
Immunohistochemistry: POLR3A Antibody [NBP2-32648] - breast
![Immunohistochemistry: POLR3A Antibody [NBP2-32648] - Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5030_POLR3A-Antibody-Immunohistochemistry-NBP2-32648-img0002.jpg)
Immunohistochemistry: POLR3A Antibody [NBP2-32648] - Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
![Immunohistochemistry: POLR3A Antibody [NBP2-32648] - Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5031_POLR3A-Antibody-Immunohistochemistry-NBP2-32648-img0003.jpg)
Immunohistochemistry: POLR3A Antibody [NBP2-32648] - Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
![Immunohistochemistry: POLR3A Antibody [NBP2-32648] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5032_POLR3A%2520Antibody-Immunohistochemistry-NBP2-32648-img0005.jpg)
Immunohistochemistry: POLR3A Antibody [NBP2-32648] - liver cancer