KBTBD6 Antibody
| Name | KBTBD6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32049 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KBTBD6 Protein |
| Description | Rabbit Polyclonal |
| Gene | KBTBD6 |
| Supplier Page | Shop |
![Immunohistochemistry: KBTBD6 Antibody [NBP2-32049] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5069_KBTBD6-Antibody-Immunohistochemistry-NBP2-32049-img0003.jpg)
![Immunohistochemistry: KBTBD6 Antibody [NBP2-32049] - Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5070_KBTBD6-Antibody-Immunohistochemistry-NBP2-32049-img0001.jpg)
![Immunohistochemistry: KBTBD6 Antibody [NBP2-32049] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5072_KBTBD6%2520Antibody-Immunohistochemistry-NBP2-32049-img0004.jpg)