TCTE3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-32040
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: PSMFEKEAYTQILRERLRESIHNVQYVEPPFDDSIADIGKEWKSALAKLKFANSYRMEPLKKFQA
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: TCTE3 Protein
• Description: Rabbit Polyclonal
• Gene: TCTE3

Product images

Immunohistochemistry: TCTE3 Antibody [NBP2-32040] - liver

Immunohistochemistry: TCTE3 Antibody [NBP2-32040] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Immunohistochemistry: TCTE3 Antibody [NBP2-32040] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Immunohistochemistry: TCTE3 Antibody [NBP2-32040] - liver cancer