COBLL1 Antibody
| Name | COBLL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32033 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NNSAHNEQNSQIPTPTDGPSFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKLKRVTIPSNTISVNGRSRLSHSMSPD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | COBLL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | COBLL1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: COBLL1 Antibody [NBP2-32033] - stomach 2](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5097_COBLL1-Antibody-Immunohistochemistry-NBP2-32033-img0003.jpg)
Immunohistochemistry: COBLL1 Antibody [NBP2-32033] - stomach 2
![Immunohistochemistry: COBLL1 Antibody [NBP2-32033] - Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5098_COBLL1-Antibody-Immunohistochemistry-NBP2-32033-img0001.jpg)
Immunohistochemistry: COBLL1 Antibody [NBP2-32033] - Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
![Immunohistochemistry: COBLL1 Antibody [NBP2-32033] - Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5099_COBLL1-Antibody-Immunohistochemistry-NBP2-32033-img0002.jpg)
Immunohistochemistry: COBLL1 Antibody [NBP2-32033] - Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
![Immunohistochemistry: COBLL1 Antibody [NBP2-32033] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5100_COBLL1%2520Antibody-Immunohistochemistry-NBP2-32033-img0004.jpg)
Immunohistochemistry: COBLL1 Antibody [NBP2-32033] - liver cancer