C5orf51 Antibody
| Name | C5orf51 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32025 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C5orf51 Protein |
| Description | Rabbit Polyclonal |
| Gene | C5orf51 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: C5orf51 Antibody [NBP2-32025] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7097_C5orf51-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32025-img0007.jpg)
![Immunohistochemistry: C5orf51 Antibody [NBP2-32025] - Staining of human liver shows strong cytoplasmic positivity (granular pattern) in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7098_C5orf51-Antibody-Immunohistochemistry-NBP2-32025-img0004.jpg)