DENND5B Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31971
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: DENND5B Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: DENND5B
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: DENND5B Antibody [NBP2-31971] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & microtubules.

Immunohistochemistry: DENND5B Antibody [NBP2-31971] - Staining of glioma.

Immunohistochemistry: DENND5B Antibody [NBP2-31971] - Staining of human testis shows moderate cytoplasmic and membranous positivity in cells in seminiferus ducts.

Immunohistochemistry: DENND5B Antibody [NBP2-31971] - Staining of liver.