RTBDN Antibody
| Name | RTBDN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31918 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RTBDN Protein |
| Description | Rabbit Polyclonal |
| Gene | RTBDN |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: RTBDN Antibody [NBP2-31918] - Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in luminal glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5204_RTBDN-Antibody-Immunohistochemistry-NBP2-31918-img0003.jpg)
Immunohistochemistry: RTBDN Antibody [NBP2-31918] - Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in luminal glandular cells.
![Immunohistochemistry: RTBDN Antibody [NBP2-31918] - Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in luminal glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5205_RTBDN-Antibody-Immunohistochemistry-NBP2-31918-img0001.jpg)
Immunohistochemistry: RTBDN Antibody [NBP2-31918] - Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in luminal glandular cells.
![Immunohistochemistry: RTBDN Antibody [NBP2-31918] - breast cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5206_RTBDN-Antibody-Immunohistochemistry-NBP2-31918-img0002.jpg)
Immunohistochemistry: RTBDN Antibody [NBP2-31918] - breast cancer
![Immunohistochemistry: RTBDN Antibody [NBP2-31918] - breast cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5207_RTBDN%2520Antibody-Immunohistochemistry-NBP2-31918-img0004.jpg)
Immunohistochemistry: RTBDN Antibody [NBP2-31918] - breast cancer