TEX29 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31915
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: MEYVLEVKNSPRHLLKQFTVCDVPLYDICDYNVSRDRCQELGCCFYEGVCYKKAVP
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: TEX29 Protein
• Description: Rabbit Polyclonal
• Gene: TEX29

Product images

Immunohistochemistry: TEX29 Antibody [NBP2-31915] - liver cancer

Immunohistochemistry: TEX29 Antibody [NBP2-31915] - Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in subset of glandular cells.

Immunohistochemistry: TEX29 Antibody [NBP2-31915] - Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in subset of glandular cells.

Immunohistochemistry: TEX29 Antibody [NBP2-31915] - pancreas