VNN2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31906
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: LLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTVC
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: VNN2 Protein
• Description: Rabbit Polyclonal
• Gene: VNN2

Product images

Immunohistochemistry: VNN2 Antibody [NBP2-31906] - pancreas

Immunohistochemistry: VNN2 Antibody [NBP2-31906] - Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry: VNN2 Antibody [NBP2-31906] - Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry: VNN2 Antibody [NBP2-31906] - pancreatic cancer