C2orf68 Antibody
| Name | C2orf68 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31905 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C2orf68 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C2orf68 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C2orf68 Antibody [NBP2-31905] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10657_C2orf68%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31905-img0006.jpg)
Immunocytochemistry/Immunofluorescence: C2orf68 Antibody [NBP2-31905] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & mitochondria.
![Immunohistochemistry: C2orf68 Antibody [NBP2-31905] - Staining of human heart muscle shows strong positivity in intercalated discs.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10658_C2orf68-Antibody-Immunohistochemistry-NBP2-31905-img0003.jpg)
Immunohistochemistry: C2orf68 Antibody [NBP2-31905] - Staining of human heart muscle shows strong positivity in intercalated discs.