EHD3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31896
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: PDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKE
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: EHD3 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: EHD3
• Conjugate: Unconjugated

Product images

Western Blot: EHD3 Antibody [NBP2-31896] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry: EHD3 Antibody [NBP2-31896] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.

Western Blot: EHD3 Antibody [NBP2-31896] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue