KRT82 Antibody
| Name | KRT82 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31895 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAG |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KRT82 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: KRT82 Antibody [NBP2-31895] - colon](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5255_KRT82-Antibody-Immunohistochemistry-NBP2-31895-img0004.jpg)
Immunohistochemistry: KRT82 Antibody [NBP2-31895] - colon
![Immunohistochemistry: KRT82 Antibody [NBP2-31895] - Immunohistochemical staining of human skin shows strong cytoplasmic positivity in stratum granulosum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5256_KRT82-Antibody-Immunohistochemistry-NBP2-31895-img0002.jpg)
Immunohistochemistry: KRT82 Antibody [NBP2-31895] - Immunohistochemical staining of human skin shows strong cytoplasmic positivity in stratum granulosum.
![Immunohistochemistry: KRT82 Antibody [NBP2-31895] - Immunohistochemical staining of human skin shows strong cytoplasmic positivity in stratum granulosum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5257_KRT82-Antibody-Immunohistochemistry-NBP2-31895-img0003.jpg)
Immunohistochemistry: KRT82 Antibody [NBP2-31895] - Immunohistochemical staining of human skin shows strong cytoplasmic positivity in stratum granulosum.
![Immunohistochemistry: KRT82 Antibody [NBP2-31895] - skin cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5258_KRT82%2520Antibody-Immunohistochemistry-NBP2-31895-img0005.jpg)
Immunohistochemistry: KRT82 Antibody [NBP2-31895] - skin cancer