FAM71E1 Antibody
| Name | FAM71E1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31870 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PGGMAASPTGRPRRLQRYLQSGEFDQFRDFPIFESNFVQFCPDIYPAPTSDLWPQVTRLGEVANEVTMGVAASSPALELPDLL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM71E1 Protein |
| Description | Rabbit Polyclonal |
| Gene | FAM71E1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: FAM71E1 Antibody [NBP2-31870] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5291_FAM71E1-Antibody-Immunohistochemistry-NBP2-31870-img0005.jpg)
Immunohistochemistry: FAM71E1 Antibody [NBP2-31870] - liver
![Immunohistochemistry: FAM71E1 Antibody [NBP2-31870] - Immunohistochemical staining of human esophagus shows strong nucleolar positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5292_FAM71E1-Antibody-Immunohistochemistry-NBP2-31870-img0003.jpg)
Immunohistochemistry: FAM71E1 Antibody [NBP2-31870] - Immunohistochemical staining of human esophagus shows strong nucleolar positivity in squamous epithelial cells.
![Immunohistochemistry: FAM71E1 Antibody [NBP2-31870] - Immunohistochemical staining of human esophagus shows strong nucleolar positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5293_FAM71E1-Antibody-Immunohistochemistry-NBP2-31870-img0004.jpg)
Immunohistochemistry: FAM71E1 Antibody [NBP2-31870] - Immunohistochemical staining of human esophagus shows strong nucleolar positivity in squamous epithelial cells.
![Immunohistochemistry: FAM71E1 Antibody [NBP2-31870] - testis cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5294_FAM71E1%2520Antibody-Immunohistochemistry-NBP2-31870-img0006.jpg)
Immunohistochemistry: FAM71E1 Antibody [NBP2-31870] - testis cancer