ArgRS Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31978
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: LSVDSLLEKDNDHSRPDIQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFSGLP
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: ArgRS Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: RARS2

Product images

Immunohistochemistry: ArgRS Antibody [NBP2-31978] - liver

Immunohistochemistry: ArgRS Antibody [NBP2-31978] - Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in astrocytes.

Immunohistochemistry: ArgRS Antibody [NBP2-31978] - Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in astrocytes.

Immunohistochemistry: ArgRS Antibody [NBP2-31978] - glioma