TMED7-TICAM2 Antibody
| Name | TMED7-TICAM2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90949 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TMED7-TICAM2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TMED7-TICAM2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: TMED7-TICAM2 Antibody [NBP1-90949] - Analysis in human cell line CAPAN-2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25302_TMED7-TICAM2%2520Antibody-Western%2520Blot-NBP1-90949-img0006.jpg)
![Immunohistochemistry-Paraffin: TMED7-TICAM2 Antibody [NBP1-90949] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25303_TMED7-TICAM2-Antibody-Immunohistochemistry-Paraffin-NBP1-90949-img0003.jpg)