Endothelin 2 Antibody
| Name | Endothelin 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87942 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Endothelin 2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | EDN2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Endothelin 2 Antibody [NBP1-87942] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5583_Endothelin-2-Antibody-Western-Blot-NBP1-87942-img0004.jpg)
Western Blot: Endothelin 2 Antibody [NBP1-87942] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunohistochemistry: Endothelin 2 Antibody [NBP1-87942] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5584_Endothelin-2-Antibody-Immunohistochemistry-NBP1-87942-img0005.jpg)
Immunohistochemistry: Endothelin 2 Antibody [NBP1-87942] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.