Connexin 32/GJB1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-85531
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human, Mouse, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:ACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSA
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: Connexin 32/GJB1 Protein
• Description: Rabbit Polyclonal
• Gene: GJB1

Product images

Western Blot: GJB1 Antibody [NBP1-85531] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).

Immunohistochemistry-Paraffin: GJB1 Antibody [NBP1-85531] - Immunohistochemical staining of human kidney shows strong cytoplasmic and extracellular positivity in cells of tubules.

Western Blot: GJB1 Antibody [NBP1-85531] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp