DNAJC7 Antibody

Name DNAJC7 Antibody
Supplier Novus Biologicals
Catalog NBP1-86920
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVME
Purity/Format Immunogen affinity purified
Blocking Peptide DNAJC7 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene DNAJC7
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.