GERP Antibody
| Name | GERP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89775 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:CSVDNCYCSSVANHGGHQPYPRSGHFPWTVPSQEYSHPLPPTPSVPQSLPSLAVRDWLDASQQPGHQDFYRVYGQPSTKHYVTS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GERP Protein |
| Description | Rabbit Polyclonal |
| Gene | TRIM8 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: GERP Antibody [NBP1-89775] Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5856_GERP%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89775-img0003.jpg)
Immunocytochemistry/Immunofluorescence: GERP Antibody [NBP1-89775] Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: GERP Antibody [NBP1-89775] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells ( goblet cells ).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5857_GERP%2520Antibody-Immunohistochemistry-Paraffin-NBP1-89775-img0002.jpg)
Immunohistochemistry-Paraffin: GERP Antibody [NBP1-89775] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells ( goblet cells ).
![Immunocytochemistry/Immunofluorescence: GERP Antibody [NBP1-89775] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5858_GERP%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89775-img0001.jpg)
Immunocytochemistry/Immunofluorescence: GERP Antibody [NBP1-89775] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.