MORN5 Antibody
| Name | MORN5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91230 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWENGLAIKGTYTFSDGLHYD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MORN5 Protein |
| Description | Rabbit Polyclonal |
| Gene | MORN5 |
| Supplier Page | Shop |
Product images
![Western Blot: MORN5 Antibody [NBP1-91230] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: RT-4. Lane 3: U-251 MG. Lane 4: Human Plasma. Lane 5: Liver. Lane 6: Tonsil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5974_MORN5-Antibody-Western-Blot-NBP1-91230-img0008.jpg)
Western Blot: MORN5 Antibody [NBP1-91230] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: RT-4. Lane 3: U-251 MG. Lane 4: Human Plasma. Lane 5: Liver. Lane 6: Tonsil.
![Immunocytochemistry/Immunofluorescence: MORN5 Antibody [NBP1-91230] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5975_MORN5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91230-img0006.jpg)
Immunocytochemistry/Immunofluorescence: MORN5 Antibody [NBP1-91230] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry-Paraffin: MORN5 Antibody [NBP1-91230] - Staining of human duodenum shows strong positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/5976_MORN5-Antibody-Immunohistochemistry-Paraffin-NBP1-91230-img0007.jpg)
Immunohistochemistry-Paraffin: MORN5 Antibody [NBP1-91230] - Staining of human duodenum shows strong positivity in glandular cells.