C16orf95 Antibody
| Name | C16orf95 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91131 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C16orf95 Protein |
| Description | Rabbit Polyclonal |
| Gene | C16orf95 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C16orf95 Antibody [NBP1-91131] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26509_C16orf95-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91131-img0004.jpg)
Immunocytochemistry/Immunofluorescence: C16orf95 Antibody [NBP1-91131] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: C16orf95 Antibody [NBP1-91131] - Staining of human duodenum shows distinct positivity in enteroendocrine cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26510_C16orf95-Antibody-Immunohistochemistry-Paraffin-NBP1-91131-img0006.jpg)
Immunohistochemistry-Paraffin: C16orf95 Antibody [NBP1-91131] - Staining of human duodenum shows distinct positivity in enteroendocrine cells.
![Immunohistochemistry-Paraffin: C16orf95 Antibody [NBP1-91131] - Staining of human duodenum shows distinct positivity in enteroendocrine cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26511_C16orf95-Antibody-Immunohistochemistry-Paraffin-NBP1-91131-img0005.jpg)
Immunohistochemistry-Paraffin: C16orf95 Antibody [NBP1-91131] - Staining of human duodenum shows distinct positivity in enteroendocrine cells.