TRIM14 Antibody
| Name | TRIM14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NB110-40872 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit |
| Antigen | synthetic peptide corresponding to a region of Human TRIM14 with an internal ID of P05932. Peptide sequence TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TRIM14 |
| Supplier Page | Shop |
Product images
![Western Blot: TRIM14 Antibody [NB110-40872] - Jurkat Whole Cell, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/7367_TRIM14%2520Antibody-Western%2520Blot-NB110-40872-img0003.jpg)
Western Blot: TRIM14 Antibody [NB110-40872] - Jurkat Whole Cell, concentration 2.5 ug/ml.