ATP5F1 Antibody
| Name | ATP5F1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54702 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ATP5F1(ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1) The peptide sequence was selected from the middle region of ATP5F1. Peptide sequence VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEK |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ATP5F1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ATP5F1 Antibody [NBP1-54702] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml ATP5F1 is supported by BioGPS gene expression data to be expressed in MCF7](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7377_ATP5F1-Antibody-Western-Blot-NBP1-54702-img0003.jpg)
![Western Blot: ATP5F1 Antibody [NBP1-54702] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7378_ATP5F1-Antibody-Western-Blot-NBP1-54702-img0002.jpg)