Beta Lactamase Antibody

Name Beta Lactamase Antibody
Supplier Novus Biologicals
Catalog NBP1-54686
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LACTB(lactamase, beta) The peptide sequence was selected from the C terminal of LACTB. Peptide sequence TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LACTB
Conjugate Unconjugated
Supplier Page Shop

Product images