NT5M Antibody

Name NT5M Antibody
Supplier Novus Biologicals
Catalog NBP1-54683
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NT5M(5',3'-nucleotidase, mitochondrial) The peptide sequence was selected from the N terminal of NT5M. Peptide sequence ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NT5M
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.