MRPL48 Antibody

Name MRPL48 Antibody
Supplier Novus Biologicals
Catalog NBP1-54676
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MRPL48(mitochondrial ribosomal protein L48) The peptide sequence was selected from the middle region of MRPL48. Peptide sequence KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MRPL48
Conjugate Unconjugated
Supplier Page Shop

Product images