GRPEL2 Antibody

Name GRPEL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54666
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Dog, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to GRPEL2(GrpE-like 2, mitochondrial (E. coli)) The peptide sequence was selected from the middle region of GRPEL2. Peptide sequence HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene GRPEL2
Supplier Page Shop

Product images