MTHFD2 Antibody

Name MTHFD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54655
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Dog, Horse, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to MTHFD2(methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 ) The peptide sequence was selected from the N terminal of MTHFD2. Peptide sequence LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene MTHFD2
Supplier Page Shop

Product images