Name | MTHFD2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54655 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to MTHFD2(methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 ) The peptide sequence was selected from the N terminal of MTHFD2. Peptide sequence LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | MTHFD2 |
Supplier Page | Shop |