| Name | DPS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54645 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PDSS1(prenyl (decaprenyl) diphosphate synthase, subunit 1) The peptide sequence was selected from the middle region of PDSS1. Peptide sequence GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | PDSS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |