LYPLA1 Antibody

Name LYPLA1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54612
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LYPLA1(lysophospholipase I) The peptide sequence was selected from the middle region of LYPLA1. Peptide sequence SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LYPLA1
Conjugate Unconjugated
Supplier Page Shop

Product images