ATP6V1E2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54601
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ATP6V1E2(ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2) The peptide sequence was selected from the middle region of ATP6V1E2. Peptide sequence LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ATP6V1E2
• Conjugate: Unconjugated