Proteasome 20S beta 3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54591
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PSMB3(proteasome (prosome, macropain) subunit, beta type, 3) The peptide sequence was selected from the middle region of PSMB3. Peptide sequence LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PSMB3
• Conjugate: Unconjugated