Name | NDUFC1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54760 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Pig, Dog, Horse, Rabbit |
Antigen | Synthetic peptides corresponding to NDUFC1(NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa) The peptide sequence was selected from the middle region of NDUFC1. Peptide sequence RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRR |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | NDUFC1 |
Supplier Page | Shop |