NDUFC1 Antibody

Name NDUFC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54760
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Pig, Dog, Horse, Rabbit
Antigen Synthetic peptides corresponding to NDUFC1(NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa) The peptide sequence was selected from the middle region of NDUFC1. Peptide sequence RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRR
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene NDUFC1
Supplier Page Shop

Product images