Troponin T type 1 (slow skeletal) Antibody
| Name | Troponin T type 1 (slow skeletal) Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54820 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to Troponin T type 1 (slow skeletal) The peptide sequence was selected from the middle region of Troponin T type 1 (slow skeletal) Peptide sequence WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TNNT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Troponin T type 1 (slow skeletal) Antibody [NBP1-54820] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14775_Troponin%2520T%2520type%25201%2520(slow%2520skeletal)%2520Antibody-Western%2520Blot-NBP1-54820-img0002.jpg)
Western Blot: Troponin T type 1 (slow skeletal) Antibody [NBP1-54820] - Human Muscle lysate, concentration 0.2-1 ug/ml.