Protocadherin-17 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54818
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PCDH17(protocadherin 17) The peptide sequence was selected from the C terminal of PCDH17. Peptide sequence SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PCDH17
• Conjugate: Unconjugated