Lactate Dehydrogenase C Antibody

Name Lactate Dehydrogenase C Antibody
Supplier Novus Biologicals
Catalog NBP1-54798
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LDHC(lactate dehydrogenase C) The peptide sequence was selected from the middle region of LDHC. Peptide sequence IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LDHC
Conjugate Unconjugated
Supplier Page Shop

Product images