MTCH2 Antibody

Name MTCH2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54791
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MTCH2(mitochondrial carrier homolog 2 (C. elegans)) The peptide sequence was selected from the N terminal of MTCH2. Peptide sequence TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MTCH2
Conjugate Unconjugated
Supplier Page Shop

Product images