ACADSB Antibody

Name ACADSB Antibody
Supplier Novus Biologicals
Catalog NBP1-54788
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACADSB(acyl-Coenzyme A dehydrogenase, short/branched chain) The peptide sequence was selected from the middle region of ACADSB (NP_001600). Peptide sequence GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACADSB
Conjugate Unconjugated
Supplier Page Shop

Product images