Name | ACADSB Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54788 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ACADSB(acyl-Coenzyme A dehydrogenase, short/branched chain) The peptide sequence was selected from the middle region of ACADSB (NP_001600). Peptide sequence GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ACADSB |
Conjugate | Unconjugated |
Supplier Page | Shop |