TTL Antibody

Name TTL Antibody
Supplier Novus Biologicals
Catalog NBP1-54787
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TTL(tubulin tyrosine ligase) The peptide sequence was selected from the middle region of TTL. Peptide sequence LYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TTL
Conjugate Unconjugated
Supplier Page Shop

Product images