Name | NDUFV1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54780 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to NDUFV1(NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa) The peptide sequence was selected from the N terminal of NDUFV1. Peptide sequence FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | NDUFV1 |
Conjugate | Unconjugated |
Supplier Page | Shop |