NDUFV1 Antibody

Name NDUFV1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54780
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NDUFV1(NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa) The peptide sequence was selected from the N terminal of NDUFV1. Peptide sequence FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene NDUFV1
Conjugate Unconjugated
Supplier Page Shop

Product images