FECH Antibody
| Name | FECH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54863 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FECH(ferrochelatase (protoporphyria)) The peptide sequence was selected from the N terminal of FECH. Peptide sequence QHAQGAKPQVQPQKRYESNIRKPKTGILMLNMGGPETLGDVHDFLLRLFL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FECH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FECH Antibody [NBP1-54863] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24780_FECH-Antibody-Western-Blot-NBP1-54863-img0001.jpg)
![Immunohistochemistry-Paraffin: FECH Antibody [NBP1-54863] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24781_FECH-Antibody-Immunohistochemistry-Paraffin-NBP1-54863-img0003.jpg)