WDR13 Antibody

Name WDR13 Antibody
Supplier Novus Biologicals
Catalog NBP1-54843
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WDR13 (WD repeat domain 13) The peptide sequence was selected from the N terminal of WDR13. Peptide sequence GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene WDR13
Conjugate Unconjugated
Supplier Page Shop

Product images