LONRF3 Antibody

Name LONRF3 Antibody
Supplier Novus Biologicals
Catalog NBP1-54834
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LONRF3(LON peptidase N-terminal domain and ring finger 3) The peptide sequence was selected from the middle region of LONRF3. Peptide sequence LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LONRF3
Conjugate Unconjugated
Supplier Page Shop

Product images