ASB6 Antibody

Name ASB6 Antibody
Supplier Novus Biologicals
Catalog NBP1-58945
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Zebrafish
Antigen Synthetic peptides corresponding to ASB6(ankyrin repeat and SOCS box-containing 6) The peptide sequence was selected from the middle region of ASB6. Peptide sequence LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ASB6
Supplier Page Shop

Product images