DIRAS1 Antibody

Name DIRAS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58888
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DIRAS1(DIRAS family, GTP-binding RAS-like 1) The peptide sequence was selected from the N terminal of DIRAS1. Peptide sequence PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DIRAS1
Conjugate Unconjugated
Supplier Page Shop

Product images