OTUD6B Antibody

Name OTUD6B Antibody
Supplier Novus Biologicals
Catalog NBP1-58879
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OTUD6B(OTU domain containing 6B) The peptide sequence was selected from the middle region of OTUD6B. Peptide sequence EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OTUD6B
Conjugate Unconjugated
Supplier Page Shop

Product images