RGS11 Antibody

Name RGS11 Antibody
Supplier Novus Biologicals
Catalog NBP1-58877
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RGS11(regulator of G-protein signaling 11) The peptide sequence was selected from the middle region of RGS11. Peptide sequence LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RGS11
Conjugate Unconjugated
Supplier Page Shop

Product images