| Name | RAB18 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58863 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RAB18(RAB18, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB18. Peptide sequence LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAB18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |