SNX7 Antibody
| Name | SNX7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58862 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SNX7(sorting nexin 7) The peptide sequence was selected from the middle region of SNX7. Peptide sequence LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SNX7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SNX7 Antibody [NBP1-58862] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7452_SNX7-Antibody-Western-Blot-NBP1-58862-img0003.jpg)
![Western Blot: SNX7 Antibody [NBP1-58862] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7453_SNX7%2520Antibody-Western%2520Blot-NBP1-58862-img0004.jpg)